Transforming growth factor, beta 2, cetermin, Glioblastoma-derived T-cell suppressor factor, polyergin, G-TSF, TGF-beta2, TGF-beta-2, transforming growth factor beta-2, BSC-1 cell growth inhibitor, TGFB-2.

Polyclonal Rabbit Antibody.

TGFB2 is a 27.08 kDa protein having two identical 118 amino acid peptide chains linked by a single disulfide bond. TGFB2 is part of a family of five related cytokines that have an extensive variation of normal and neoplastic cells, indicating the importance of these homo-dimmer proteins as multi-functional regulators of cellular activity. The three mammalian isoforms of TGF-b (TGFb1, TGFb2 and TGFb3) signal through the same receptor and stimulate similar biological responses. They are involved in physiological processes as embryogenesis, tissue remodelling and wound healing.

Sterile Filtered White lyophilized (freeze-dried) powder.

Greater than 98%.

IgG Anti Human TGFb-2 is developed in rabbit using recombinant Human TGFb-2 produced in plants.

ALDAAYCFRNVQDNCCLRPLYIDFKRDLGWKWIHEPKGYNANFCAGACPYLWSSDTQHSRVLSLYNTINPEA
SASPCCVSQDLEPLTILYYIGKTPKIEQLSNMIVKSCKCS

Purified IgG prepared by affinity chromatography on protein G.

Lyophilized from a sterile filtered (0.2μm) solution containing phosphate buffered saline.

Add distilled water at 1:2 ratio and let the lyophilized pellet dissolve completely.

Western Blot: to detect human TGFb2 by WB analysis this antibody can be used in a dilution of 1/1,000.

Store at -20°C. For long term storage freezes in working aliquots at -20°C.
Repeated freezing and thawing is not recommended.

SDS

ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.